Aaj: Vedic Astrology & Jyotish · Free · Precise
Vol. I · No. 1 · Est. MMXXVIWednesday, 19 August 2026Free · Vedic · Precise
VedicBirth
Vedic Astrology & Jyotish Calculations
8,241Kundlis Generated
50+Free Tools
27Nakshatras
12Rashis Decoded
100%Free Forever

Boy Name · Sanskrit Origin

Ribhav

ऋभव

vediccraftsmanrarevishwakarmaimmortal

Quick Answer

Ribhav (ऋभव) is a Sanskrit-origin boy's name meaning "skilled craftsman." It is associated with Chitra nakshatra and Tula rashi. The Chaldean numerology value is 8 (Power).

Meaning & Etymology

Meaning

skilled craftsman · divine artisan · clever maker

Etymology

From the Vedic "Ribhus", divine craftsmen who created the chariot of the Ashwins and other celestial wonders. Ribhav is one of the Ribhus. Ri syllable aligns with Chitra (Tula). A direct Vedic parallel to Vishwakarma's domain.

Vedic Astrology Connection

Nakshatra

Chitra
Lord
Mars
Deity
Vishwakarma
Symbol
Pearl

Rashi (Moon Sign)

Tula

Prescribed Letters

Pe (पे)Po (पो)Ra (रा)Ri (री)

In Vedic tradition, names starting with specific syllables are prescribed for children born under each nakshatra.Ribhav begins with "Ri", which corresponds to Chitra nakshatra. The ruling planet Mars influences the personality and life path of Ribhav.

Numerology of Ribhav

8Power

Authoritative, ambitious, material. Natural executives and strategists. Ability to manifest goals in the material world.

Calculated using Chaldean numerology system: each letter of "Ribhav" maps to a number, and the sum is reduced to a single digit (or master number 11/22). This method is rooted in ancient Babylonian numerology and widely used in Vedic practice.

At a Glance

NameRibhav (ऋभव)
GenderBoy
Meaningskilled craftsman, divine artisan, clever maker
OriginSanskrit
Syllables2
NakshatraChitra
RashiTula
Numerology8 (Power)
Popularityrare
RegionNorth India, Vedic communities, Pan-India

Famous People Named Ribhav

  • The Ribhus, Vedic divine craftsmen who earned immortality through their skill

Similar Names

Why This Name Fits Chitra Nakshatra

In Vedic astrology, the nakshatra (lunar mansion) at the time of birth determines which syllables are auspicious for the child's name. Chitranakshatra prescribes names starting with "Pe", "Po", "Ra", "Ri".Ribhav begins with "Ri", making it a traditionally appropriate choice for children born under Chitra.

The belief is that using the correct starting syllable aligns the child's name with the vibrational energy of their birth nakshatra, creating harmony between the individual and the cosmos. This practice is recorded in the Brihat Parashara Hora Shastra and is still widely followed across India.

Learn more about Chitra nakshatra →

Frequently Asked Questions

What does Ribhav mean?

Ribhav (ऋभव) means "skilled craftsman, divine artisan, clever maker". It is of Sanskrit origin. From the Vedic "Ribhus", divine craftsmen who created the chariot of the Ashwins and other celestial wonders. Ribhav is one of the Ribhus. Ri syllable aligns with Chitra (Tula). A direct Vedic paralle...

Which nakshatra is Ribhav for?

Ribhav is traditionally recommended for children born under Chitra nakshatra, as it starts with the prescribed syllable "Ri".

What is the numerology number of Ribhav?

The Chaldean numerology number of Ribhav is 8, which represents Power: Authoritative, ambitious, material. Natural executives and strategists. Ability to manifest goals in the material world.

Is Ribhav a popular name in India?

Ribhav is considered a rare name, particularly popular in North India, Vedic communities, Pan-India.

Explore More